PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D01G1482
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 253aa    MW: 28784.5 Da    PI: 8.4988
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D01G1482genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.61.4e-131361148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+ +Ede+l++++++ G   +W+t ++  g+ R++k+c++rw +yl
      Gh_D01G1482 13 KGAWSMQEDEKLLNYIRKNGEAgCWRTLPQAAGLLRCGKSCRLRWINYL 61
                     79******************989**********99************97 PP

2Myb_DNA-binding53.84.5e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++ ++Ed+l+++++++lG++ W++Ia +++ gRt++++k++w+++l
      Gh_D01G1482  67 RGNFGEDEDDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-19463IPR009057Homeodomain-like
PROSITE profilePS5129411.87861IPR017930Myb domain
SuperFamilySSF466892.41E-2511108IPR009057Homeodomain-like
SMARTSM007176.2E-91263IPR001005SANT/Myb domain
PfamPF002496.6E-121361IPR001005SANT/Myb domain
CDDcd001672.20E-61561No hitNo description
PROSITE profilePS5129426.59262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-2664117IPR009057Homeodomain-like
SMARTSM007172.3E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1567112IPR001005SANT/Myb domain
CDDcd001671.72E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MRKPCCDKRD TNKGAWSMQE DEKLLNYIRK NGEAGCWRTL PQAAGLLRCG KSCRLRWINY  60
LRPDVKRGNF GEDEDDLIIK LHALLGNRWS LIAGRLPGRT DNEVKNYWNS HLRRKLINMG  120
IDPNKHSLTR HNRPHHNSNT NTSASATLIS SASKLPKSHK CIALPNNKPW RDNDQVSDAA  180
SCLLEDEDDD NLPCSTTQYQ LPDLNLELTI SVSAPTAKLE QHIHQIQEPN HKQCSNISSD  240
LHFSPTPTLL LFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26101164108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467309.10.0PREDICTED: myb-related protein 308-like
SwissprotQ9SZP12e-80MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A0D2NPJ80.0A0A0D2NPJ8_G
STRINGVIT_01s0011g04760.t012e-96(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2506234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.14e-79myb domain protein 4